Recombinant Mouse MAP4K1/HPK1 Protein
Beta LifeScience
SKU/CAT #: BLA-9952P
Recombinant Mouse MAP4K1/HPK1 Protein
Beta LifeScience
SKU/CAT #: BLA-9952P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P70218 |
Synonym | Hematopoietic progenitor kinase Hematopoietic progenitor kinase 1 HPK1 Human Hematopoietic Progenitor Kinase M4K1_HUMAN Map4k1 MAPK/ERK kinase kinase kinase 1 MEK kinase kinase 1 MEKKK 1 Mitogen activated protein kinase kinase kinase kinase 1 Mitogen-activated protein kinase kinase kinase kinase 1 |
Description | Recombinant Mouse MAP4K1/HPK1 Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MALVDPDIFNKDPREHYDLLQRLGGGTYGEVFKARDKVSKDLVALKMVKM EPDDDVATLQKEILMLKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQ DIYQVTGSLSELQISYVCREVLQGLAYLHSEKKIHRDIKGANILINDCGE VKLADFGISAQIGATLARRLSFIGTPYWMAPEVAAVALKGGYNELCDIWS LGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRLKEKSRWSSSFHNF VKVTLTKNSKKRPSATKMLSHQLVSQPGLNRGLILDLLDKMKNPGKGLPV DIEDEEPEPPPAIPRRIRSTYRASSLGIPDADCCRRQMEFQRPRCV |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity ofthis protein was determined to be 70.6 nmol/min/mg in kinase assay using MBP substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |