Recombinant Mouse MAP3K8/COT Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9951P
Recombinant Mouse MAP3K8/COT Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9951P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q07174 |
Synonym | AURA2 c COT Cancer Osaka thyroid oncogene CCOT COT COT proto oncogene serine/threonine protein kinase EST ESTF Ewing sarcoma transformant FLJ10486 M3K8_HUMAN MAP3K 8 MAP3K8 MEKK8 Mitogen activated protein kinase kinase kinase 8 Mitogen-activated protein kinase kinase kinase 8 Proto oncogene cCot Proto-oncogene c-Cot Serine/threonine protein kinase cot Serine/threonine-protein kinase cot TPL 2 TPL-2 TPL2 Tumor progression locus 2 |
Description | Recombinant Mouse MAP3K8/COT Protein (His tag) was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MENLYASEEPGVYEPSLMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYG TVEDLLAFANHVSNMTKHFYGRRPQECGILLNMVISPQNGRYQIDSDVLL VPWKLTYRNIGSGFVPRGAFGKVYLAQDMKTKKRMACKLIPIDQFKPSDV EIQACFRHENIAELYGAVLWGDTVHLFMEAGEGGSVLEKLESCGPMREFE IIWVTKHILKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVKMTE DVYLPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVK RYPRSAYPSYLYIIHKQAPPLEDIAGDCSPGMRELIEAALERNPNHRPKA ADLLKHEALNPPREDQPR |
Molecular Weight | 70 kDa including tags |
Purity | >= 38% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific Activity:8.5 pmole/min/mg. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |