Recombinant Mouse LTBR Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-9941P
Recombinant Mouse LTBR Protein (Fc Tag)
Beta LifeScience
SKU/CAT #: BLA-9941P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P50284 |
Synonym | CD18 D12S370 LT beta R LTBETAR Ltbr Lymphotoxin B receptor Lymphotoxin beta receptor Lymphotoxin beta receptor (TNFR superfamily, member 3) Lymphotoxin-beta receptor TNF R III TNF-RIII TNFCR TNFR RP TNFR superfamily member 3 TNFR-III TNFR2 RP TNFR2RP TNFR3 TNFRII TNFRRP TNFRSF 3 TNFRSF3 TNR3_HUMAN Tumor necrosis factor C receptor Tumor necrosis factor receptor 2 related protein Tumor necrosis factor receptor 2-related protein Tumor necrosis factor receptor superfamily member 3 Tumor necrosis factor receptor superfamily member 3 precursor Tumor necrosis factor receptor type III |
Description | Recombinant Mouse LTBR Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | KPQAPELRGSSQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEF VFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCT SDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDV NCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPE PGAMPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Molecular Weight | 49 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |