Recombinant Mouse LSD2 / AOF1 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9937P
Recombinant Mouse LSD2 / AOF1 Protein (Tagged)

Recombinant Mouse LSD2 / AOF1 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9937P
Catalog No.: BLA-9937P

Product Overview

Host Species Mouse
Accession Q8CIG3
Synonym amine oxidase (flavin containing) domain 1 amine oxidase, flavin containing 1 AOF1 bA204B7.3 C6orf193 dJ298J15.2 Flavin-containing amine oxidase domain-containing protein 1 FLJ33898 FLJ34109 FLJ43328 KDM1B KDM1B_HUMAN LSD2 lysine (K)-specific demethylase 1B Lysine-specific demethylase 2 Lysine-specific histone demethylase 1B Lysine-specific histone demethylase 2
Description Recombinant Mouse LSD2 / AOF1 Protein (Tagged) was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence MAASRGRSKKRSNLELSPDNLPLRSSGRQAKKKAVEIPDEDEDGSSEKKY RKCEKAGCTAAYPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYY RSHKDGYDKYSAWKRVWTSNGKTEPSPKAFMADQQLPYWVQCTKPECGKW RQLTKEIQLTPHMARTYRCGMKPNTITKPDTPDHCSFPEDLRVLEVSNHW WYPMLIQPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTHRATVTAATTTTG SASPGEMEPSKAAPSSLVLGMNRYFQPFYQPNECGKALCVRPDVMELDEL YEFPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIR CVQEVERILYFMTRKGLINTGVLTVAAGQHLLPKHYHNKSVLVVGAGPAG LAAARQLHNFGMKVTVLEAKDRIGGRVWDDKSFKGVVVGRGPQIVNGCIN NPVALMCEQLGISMRKLGERCDLIQEGGRITDPTVDKRMDFHFNALLDVV SEWRKDKTLLQDVPLGEKIEEIYRAFVKESGIQFSELEGQVLQFHLSNLE YACGSSLHQVSARSWDHNEFFAQFAGDHTLLTPGYSTIIEKLAEGLDIRL KSPVQSIDYTGDEVQVTTTDGMGHSAQKVLVTVPLAILQRGAIQFNPPLS EKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASQRGLF AVFYDMDSQQSVLMSVITGEAVASLRTMDDKQVLQQCMGILRELFKEQEI PEPTKYFVTRWSTEPWIQMAYSFVKTFGSGEAYDIIAEEIQGTVFFAGEA TNRHFPQTVTGAYLSGVREASKIAAF
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed