Recombinant Mouse liver FABP Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9934P
Recombinant Mouse liver FABP Protein (His tag)

Recombinant Mouse liver FABP Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9934P
Catalog No.: BLA-9934P

Product Overview

Host Species Mouse
Accession P12710
Synonym FABP 1 FABP1 FABPL FABPL_HUMAN Fatty Acid Binding Protein Fatty Acid Binding Protein 1 Fatty acid binding protein 1 liver Fatty acid-binding protein Fatty acid-binding protein 1 Fatty acid-binding protein liver L FABP L-FABP liver Liver-type fatty acid-binding protein
Description Recombinant Mouse liver FABP Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMNFSGKYQLQSQENFEPFMKAIGLPED LIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGE KVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI
Molecular Weight 17 kDa including tags
Purity >95% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed