Recombinant Mouse Legumain Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9929P
Recombinant Mouse Legumain Protein (His tag)

Recombinant Mouse Legumain Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9929P
Catalog No.: BLA-9929P

Product Overview

Host Species Mouse
Accession O89017
Synonym AEP Asparaginyl endopeptidase cysteine 1 Cysteine protease 1 EC 3.4.22.34 Legumain LGMN LGMN_HUMAN LGMN1 Protease Protease cysteine 1 Protease cysteine 1 (legumain) PRSC1
Description Recombinant Mouse Legumain Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQ IIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLA VLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKD LNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKES SYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTS HVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTIL KRKLLRTN
Molecular Weight 39 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed