Recombinant Mouse KDM5B / PLU1 / Jarid1B Protein

Beta LifeScience SKU/CAT #: BLA-9921P
Recombinant Mouse KDM5B / PLU1 / Jarid1B Protein

Recombinant Mouse KDM5B / PLU1 / Jarid1B Protein

Beta LifeScience SKU/CAT #: BLA-9921P
Catalog No.: BLA-9921P

Product Overview

Host Species Mouse
Accession Q80Y84
Synonym Cancer/testis antigen 31 CT31 Histone demethylase JARID1B JARID1B Jumonji AT rich interactive domain 1B Jumonji/ARID domain-containing protein 1B Kdm5b KDM5B_HUMAN Lysine (K) specific demethylase 5B Lysine demethylase 5B Lysine specific demethylase 5B Lysine-specific demethylase 5B PLU-1 PLU1 PPP1R98 Protein phosphatase 1 regulatory subunit 98 PUT1 putative DNA/chromatin binding motif RBBP2H1A RBP2 like RBP2-H1 Retinoblastoma-binding protein 2 homolog 1 Retinoblastoma-binding protein 2 homolog 1A
Description Recombinant Mouse KDM5B / PLU1 / Jarid1B Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence EPATTLPPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHK IRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKL NFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEEGGFAVVCKDRK WTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTS DTKDKEYKPHDIPQRQSVQPAETCPPARRAKRMRAEAMNIKIEPEEATEA RTHNLRRRMGCTTPKWENEKEMKSTIKQEPTEKKDCELESEKEKPKSRAK KTATAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGDW RCPKCLAQECNKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMV PTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKISPEE EEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIE DHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQ LVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVN FCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTV QKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCIKCKTTCFM SAISCSCKPGLLVCLHHVKELCSCPPYKYNLRYRYTLDDLYPMMNALKLR
Molecular Weight 86 kDa including tags
Purity >= 50% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed