Recombinant Mouse Kallikrein 14 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9916P
Recombinant Mouse Kallikrein 14 Protein (Tagged)

Recombinant Mouse Kallikrein 14 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9916P
Catalog No.: BLA-9916P

Product Overview

Host Species Mouse
Accession Q8CGR5
Synonym hK14 Kallikrein 14 Kallikrein like protein 6 Kallikrein-14 Kallikrein-like protein 6 KLK L6 KLK-L6 KLK14 KLK14_HUMAN
Description Recombinant Mouse Kallikrein 14 Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILH VALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLG RAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQA CHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMER CAMPGYPGVYANLCNYHSWIQRTMQSN
Molecular Weight 41 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed