Recombinant Mouse Kallikrein 14 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9916P
Recombinant Mouse Kallikrein 14 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9916P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q8CGR5 |
Synonym | hK14 Kallikrein 14 Kallikrein like protein 6 Kallikrein-14 Kallikrein-like protein 6 KLK L6 KLK-L6 KLK14 KLK14_HUMAN |
Description | Recombinant Mouse Kallikrein 14 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILH VALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLG RAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQA CHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMER CAMPGYPGVYANLCNYHSWIQRTMQSN |
Molecular Weight | 41 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis. |
Subcellular Location | Secreted, extracellular space. |
Protein Families | Peptidase S1 family, Kallikrein subfamily |
Database References |