Recombinant Mouse IRE1 Protein

Beta LifeScience SKU/CAT #: BLA-9909P
Recombinant Mouse IRE1 Protein

Recombinant Mouse IRE1 Protein

Beta LifeScience SKU/CAT #: BLA-9909P
Catalog No.: BLA-9909P

Product Overview

Host Species Mouse
Accession Q9EQY0
Synonym Endoplasmic reticulum (ER) to nucleus signalling 1 Endoplasmic reticulum to nucleus signaling 1 Endoplasmic reticulum-to-nucleus signaling 1 Endoribonuclease ER to nucleus signaling 1 ERN 1 Ern1 ERN1_HUMAN hIRE 1p hIRE1p Inositol requiring 1 Inositol requiring 1, S. cerevisiae, homolog of Inositol requiring enzyme 1, S. cerevisiae, homolog of Inositol requiring protein 1 inositol-requiring enzyme 1 Inositol-requiring protein 1 IRE 1 IRE 1a IRE 1P Ire1 alpha Ire1-alpha IRE1a Ire1alpha IRE1P MGC163277 MGC163279 Protein kinase/endoribonuclease RGD1559716 Serine/threonine protein kinase/endoribonuclease IRE1
Description Recombinant Mouse IRE1 Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence SVHQQRQLQHQQFQKELEKIQLLQQQQLPFHPHGDLTQDPEFLDSSGPFS ESSGTSSPSPSPRASNHSLHPSSSASRAGTSPSLEQDDEDEETRMVIVGK ISFCPKDVLGHGAEGTIVYKGMFDNRDVAVKRILPECFSFADREVQLLRE SDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITL LHQTTSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKL AVGRHSFSRRSGVPGTEGWIAPEMLSEDCKDNPTYTVDIFSAGCVFYYVI SEGNHPFGKSLQRQANILLGACNLDCFHSDKHEDVIARELIEKMIAMDPQ QRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKEALDGPIVRQLERGGRA VVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPVEV QETLGSIPDDFVRYFTSRFPHLLSHTYQAMELCRHERLFQTYYWHEPTEP QPPVIPYAL
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific acivity of this protein was 34 nmol/min/mg in a kinase assay using myelin basic protein as substrate.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed