Recombinant Mouse IKK beta Protein

Beta LifeScience SKU/CAT #: BLA-9906P
Recombinant Mouse IKK beta Protein

Recombinant Mouse IKK beta Protein

Beta LifeScience SKU/CAT #: BLA-9906P
Catalog No.: BLA-9906P

Product Overview

Host Species Mouse
Accession O88351
Synonym I kappa B kinase 2 I kappa B kinase beta I-kappa-B kinase 2 I-kappa-B-kinase beta IkBKB IKK beta IKK-B IKK-beta IKK2 IKKB IKKB_HUMAN IMD15 Inhibitor of kappa light polypeptide gene enhancer in B cells, kinase beta Inhibitor of nuclear factor kappa-B kinase subunit beta NFKBIKB Nuclear factor NF-kappa-B inhibitor kinase beta
Description Recombinant Mouse IKK beta Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment
Source Baculovirus infected Sf9 cells
AA Sequence MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQATGEQIAIKQCRQEL SPKNRNRWCLEIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQ GGDLRRYLNQFENCCGLREGAVLTLLSDIASALRYLHENRIIHRDLKPEN IVLQQGEKRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYT VTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLN GAVKFSSSLPFPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPQYGPNGCF RALDDILNLKLVHVLNMVTGTVHTYPVTEDESLQSLKTRIQENTGILETD QELLQKAGLVLLPDKPATQCISDSKTNEGLTLDMDLVFLLDNSKINYETQ ITPRPPPESVSCILQEPKRNLSFFQLRKVWGQVWHSIQTLKEDCNRLQQG QRAAMMSLLRNNSCLSKMKNAMASTAQQLKAKLDFFKTSIQIDLEKYKEQ TEFGITSDKLLLAWREMEQAVEQCGRENDVKHLVERMMALQTDIVDLQRS PMGRKQGGTLDDLEEQARELYRKLREKPRDQRTEGDSQEMVRLLLQAIQS FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDERTVVRLQEKR QKELWNLLKIAC
Purity >85% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity The specific activity ofthis protein was 48 nmol/min/mg in a kinase assay using IKKtide synthetic peptide assubstrate.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed