Recombinant Mouse HDAC8 Protein

Beta LifeScience SKU/CAT #: BLA-9884P
Recombinant Mouse HDAC8 Protein

Recombinant Mouse HDAC8 Protein

Beta LifeScience SKU/CAT #: BLA-9884P
Catalog No.: BLA-9884P

Product Overview

Host Species Mouse
Accession Q8VH37
Synonym CDA07 CDLS5 HD 8 HD8 HDAC 8 Hdac8 HDAC8_HUMAN HDACL 1 HDACL1 Histone deacetylase 8 Histone deacetylase like 1 MRXS6 RPD 3 RPD3 WTS
Description Recombinant Mouse HDAC8 Protein was expressed in Baculovirus infected insect cells. It is a Full length protein
Source Baculovirus infected insect cells
AA Sequence MEMPEEPANSGHSLPPVYIYSPEYVSICDSLVKVPKRASMVHSLIEAYAL HKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIEYGLGY DCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEAS GFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSL HKFSPGFFPGTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKE VYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQWQLATLI LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITP SCRPDRNEPHRIQQILNYIKGNLKHVV
Molecular Weight 43 kDa including tags
Purity >90% SDS-PAGE.purified by using conventional chromatography techniques.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed