Recombinant Mouse HAPLN1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9881P
Recombinant Mouse HAPLN1 Protein (His tag)

Recombinant Mouse HAPLN1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9881P
Catalog No.: BLA-9881P

Product Overview

Host Species Mouse
Accession Q9QUP5
Synonym Cartilage link protein cartilage linking protein 1 Cartilage-link protein Cartilage-linking protein 1 CLP CRTL1 Crtl1l HAPLN1 HPLN1_HUMAN Hyaluronan and proteoglycan link protein 1 Hyaluronan and proteoglycan link protein 1 precursor LP Proteoglycan link protein
Description Recombinant Mouse HAPLN1 Protein (His tag) was expressed in Mammalian. It is a Full length protein
Source Mammalian
AA Sequence ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNV TLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGG YQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQ GVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNA GWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNF NGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAG WLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Molecular Weight 43 kDa including tags
Purity >90% by SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed