Recombinant Mouse Granzyme A Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9873P
Recombinant Mouse Granzyme A Protein (His tag)

Recombinant Mouse Granzyme A Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9873P
Catalog No.: BLA-9873P

Product Overview

Host Species Mouse
Accession P11032
Synonym CTL tryptase CTLA3 Cytolytic t cell and natural killer cell specific trypsin like serine protease Cytotoxic T lymphocyte associated serine esterase 3 Cytotoxic T lymphocyte proteinase 1 Cytotoxic T-lymphocyte proteinase 1 Fragmentin 1 Fragmentin-1 GRAA_HUMAN Granzyme 1 cytotoxic T lymphocyte associated serine esterase 3 Granzyme A Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease) Granzyme A (granzyme 1, cytotoxic T lymphocyte associated serine esterase 3) Granzyme A precursor Granzyme-1 GZMA H factor Hanukah factor serine protease Hanukkah factor HF HFSP TSP1
Description Recombinant Mouse Granzyme A Protein (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKF ILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRN VAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKIC NDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFG GEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
Molecular Weight 40 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed