Recombinant Mouse GPA33 Protein

Beta LifeScience SKU/CAT #: BLA-9871P
Recombinant Mouse GPA33 Protein

Recombinant Mouse GPA33 Protein

Beta LifeScience SKU/CAT #: BLA-9871P
Catalog No.: BLA-9871P

Product Overview

Host Species Mouse
Accession Q9JKA5
Synonym A33 Cell surface A33 antigen Cell surface A33 antigen precursor Glycoprotein A33 Glycoprotein A33 (transmembrane) Gpa33 GPA33_HUMAN MGC129986 MGC129987 OTTHUMP00000032346 Transmembrane glycoprotein A33
Description Recombinant Mouse GPA33 Protein was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVT WNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSL MSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSP QYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIES CNITVAPRPPSMNI
Molecular Weight 25 kDa including tags
Purity >95% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C. Reconstitute for long term storage.
Recently viewed