Recombinant Mouse GALNT1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9853P
Recombinant Mouse GALNT1 Protein (His tag)

Recombinant Mouse GALNT1 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9853P
Catalog No.: BLA-9853P

Product Overview

Host Species Mouse
Accession O08912
Synonym GALNAC T1 GalNAc transferase 1 GalNAc-T1 GALNT 1 GALNT1 GALT1_HUMAN Polypeptide GalNAc transferase 1 Polypeptide N acetylgalactosaminyltransferase 1 Polypeptide N-acetylgalactosaminyltransferase 1 soluble form pp GaNTase 1 pp-GaNTase 1 Protein UDP acetylgalactosaminyltransferase 1 Protein-UDP acetylgalactosaminyltransferase 1 UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 1 UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1 UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 1 (GalNAc T1) UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
Description Recombinant Mouse GALNT1 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment
Source Baculovirus infected insect cells
AA Sequence ADPGLPAGDVLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLM ASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVH SVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRS GLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPI IDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVR TPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIV TCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPG VTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNV ETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSK LNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSI RDCTGSRSQQWLLRNVTLPEIFHHHHHH
Molecular Weight 61 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed