Recombinant Mouse ANTXR2/CMG-2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-12168P
Recombinant Mouse ANTXR2/CMG-2 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-12168P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q6DFX2 |
Synonym | 2310046B19Rik Anthrax toxin receptor 2 ANTR2_HUMAN Antxr2 AW561899 Capillary morphogenesis gene 2 protein Capillary morphogenesis protein 2 CMG 2 CMG-2 CMG2 FLJ31074 HFS ISH JHF MGC111533 MGC45856 |
Description | Recombinant Mouse ANTXR2/CMG-2 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | QAQEQPSCKKAFDLYFVLDKSGSVANNWIEIYNFVHQLTERFVSPEMRLS FIVFSSQATIILPLTGDRYKIGKGLEDLKAVKPVGETYIHEGLKLANEQI QNAGGLKASSIIIALTDGKLDGLVPSYAENEAKKSRSLGASVYCVGVLDF EQAQLERIADSKDQVFPVKGGFQALKGIINSILAQSCTEILELSPSSVCV GEKFQVVLTGRAVTSISHDGSVLCTFTANSTYTKSEKPVSIQPSSILCPA PVLNKDGETLEVSISYNDGKSAVSRSLTITATECTNGLEHHHHHH |
Molecular Weight | 32 kDa including tags |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |