Recombinant Mouse Alpha B Crystallin / CRYAB Protein
Beta LifeScience
SKU/CAT #: BLA-12102P
Recombinant Mouse Alpha B Crystallin / CRYAB Protein
Beta LifeScience
SKU/CAT #: BLA-12102P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Synonym | AACRYA Alpha B crystallin Alpha crystallin B chain Alpha(B)-crystallin Alpha-crystallin B chain CRYA2 Cryab CRYAB_HUMAN Crystallin alpha B Crystallin alpha polypeptide 2 CTPP2 Heat shock 20 kD like protein Heat shock protein beta 5 Heat shock protein beta-5 HspB5 Renal carcinoma antigen NY REN 27 Renal carcinoma antigen NY-REN-27 Rosenthal fiber component |
Description | Recombinant Mouse Alpha B Crystallin / CRYAB Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLR PPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK QVSGPERTIPITREEKPAVAAAPKK |
Molecular Weight | 20 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycle. |