Recombinant Methanol dehydrogenase (mdh) Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9829P
Recombinant Methanol dehydrogenase (mdh) Protein (His tag)

Recombinant Methanol dehydrogenase (mdh) Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9829P
Catalog No.: BLA-9829P

Product Overview

Accession P31005
Description Recombinant Methanol dehydrogenase (mdh) Protein (His tag) was expressed in Yeast. It is a Full length protein
Source Yeast
AA Sequence TNFFIPPASVIGRGAVKEVGTRLKQIGAKKALIVTDAFLHSTGLSEEVAK NIREAGLDVAIFPKAQPDPADTQVHEGVDVFKQENCDALVSIGGGSSHDT AKAIGLVAANGGRINDYQGVNSVEKPVVPVVAITTTAGTGSETTSLAVIT DSARKVKMPVIDEKITPTVAIVDPELMVKKPAGLTIATGMDALSHAIEAY VAKGATPVTDAFAIQAMKLINEYLPKAVANGEDIEAREAMAYAQYMAGVA FNNGGLGLVHSISHQVGGVYKLQHGICNSVNMPHVCAFNLIAKTERFAHI AELLGENVSGLSTAAAAERAIVALERYNKNFGIPSGYAEMGVKEEDIELL AKNAFEDVCTQSNPRVATVQDIAQIIKNAL
Molecular Weight 42 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed