Recombinant IpaD Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9799P
Recombinant IpaD Protein (Tagged)

Recombinant IpaD Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9799P
Catalog No.: BLA-9799P

Product Overview

Host Species Shigella flexneri
Accession P18013
Synonym Invasin ipaD secreted by the Mxi-Spa machinery, required for entry of bacteria into epithelial cells
Description Recombinant IpaD Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDT LHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILS RNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYL KVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALE ELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINM TPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQK YSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
Molecular Weight 57 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed