Recombinant Intein CBD Protein

Beta LifeScience SKU/CAT #: BLA-9796P
Recombinant Intein CBD Protein

Recombinant Intein CBD Protein

Beta LifeScience SKU/CAT #: BLA-9796P
Catalog No.: BLA-9796P

Product Overview

Description Recombinant Intein CBD Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MKIEEGKLVIGSLEGCFAKGTNVLMADGSIECIENIEVGNKVMGKDGRPR EVIKLPRGRETMYSVVQKSQHRAHKSDSSREVPELLKFTCNATHELVVRT PRSVRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEG PERANELVESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYE NDHFFDYMQKSKFHLTIEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSL MERVTEYAEKLNLCAEYKDRKEPQVAKTVNLYSKVVRGASTNPGVSAWQV NTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQGGHGGIRNN LNTENPLWDAIVGLGFLKDGVKNIPSFLSTDNIGTRETFLAGLIDSDGYV TDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVTKHKI SYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKED DYYGITLSDDSDHQFLLGSQVVVQNLEHHHHHH
Molecular Weight 59 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed