Recombinant Human ZP3 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9786P
Recombinant Human ZP3 Protein (His tag)

Recombinant Human ZP3 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-9786P
Catalog No.: BLA-9786P

Product Overview

Host Species Human
Accession P21754
Synonym HUMZP3 Processed zona pellucida sperm-binding protein 3 Sperm receptor Zona pellucida glycoprotein 3 zona pellucida glycoprotein 3 (sperm receptor) zona pellucida glycoprotein 3A (sperm receptor) Zona pellucida glycoprotein ZP3 Zona pellucida protein C Zona pellucida sperm binding protein 3 precursor Zp-3 ZP3 ZP3 372 ZP3 424 ZP3 474 ZP3_HUMAN ZP3A ZP3A/ZP3B ZP3B ZPC
Description Recombinant Human ZP3 Protein (His tag) was expressed in Mammalian. It is a Protein fragment
Source Mammalian
AA Sequence QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLT LGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRP VGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTF SLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPT PDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFAN DSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCC NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGPLIFLDRRG DHEVEQWALPSDTSV
Molecular Weight 45 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed