Recombinant Human ZNRF1 Protein

Beta LifeScience SKU/CAT #: BLA-9783P
Recombinant Human ZNRF1 Protein

Recombinant Human ZNRF1 Protein

Beta LifeScience SKU/CAT #: BLA-9783P
Catalog No.: BLA-9783P

Product Overview

Host Species Human
Accession Q8ND25
Synonym B830022L21Rik DKFZp434E229 E3 ubiquitin protein ligase ZNRF1 E3 ubiquitin-protein ligase ZNRF1 EC 6.3.2.- FLJ14846 MGC101991 MGC15430 Nerve injury gene 283 Nerve injury induced gene 283 protein Nerve injury-induced gene 283 protein NIN283 Rnf42 Zinc and ring finger 1 zinc and ring finger protein 1 zinc finger and ring finger protein 1 Zinc/RING finger protein 1 ZNRF 1 znrf1 ZNRF1_HUMAN Zrfp1
Description Recombinant Human ZNRF1 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNG YQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSV ASDEMEMHFIMCLSKPRLSYNDDVLTLEHH HHHH*
Molecular Weight 15 kDa including tags
Purity >95% SDS-PAGE.Purity is determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed