Recombinant Human ZNHIT1 Protein

Beta LifeScience SKU/CAT #: BLA-9780P
Recombinant Human ZNHIT1 Protein

Recombinant Human ZNHIT1 Protein

Beta LifeScience SKU/CAT #: BLA-9780P
Catalog No.: BLA-9780P

Product Overview

Host Species Human
Accession O43257
Synonym CG1I CGBP1 Cyclin G1 binding protein 1 p18 Hamlet Zinc finger HIT domain containing protein 1 Zinc finger protein subfamily 4A member 1 zinc finger, HIT type 1 ZNFN4A1
Description Recombinant Human ZNHIT1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINR QLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRF RKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVS CGARYCTVRCLGTHQETRCLKWTV
Molecular Weight 20 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed