Recombinant Human Zinc finger Protein 276

Beta LifeScience SKU/CAT #: BLA-9774P
Recombinant Human Zinc finger Protein 276

Recombinant Human Zinc finger Protein 276

Beta LifeScience SKU/CAT #: BLA-9774P
Catalog No.: BLA-9774P

Product Overview

Host Species Human
Synonym AW048709 D8Ertd370e D8Ertd377e FLJ38685 FLJ77809 HGNC:23330 MGC111410 MGC126480 MGC45417 ZFP276 Zinc finger protein (C2H2 type) 276 Zinc finger protein 276 Zinc finger protein 276 homolog Zinc finger protein 477 ZNF276 ZNF477
Description Recombinant Human Zinc finger Protein 276 was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MDTSSSCKAFLLDSALAVKWPRDKETAPRLPQHRGWNPGDAPQTSQGRGT GTPVGAETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPLCRAPGQLGEK QLPSSTSDDRVKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKV SGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIYKCPYQGC TAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHT EVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKY HMTKHKAETELDFACDQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEA EPPPGPPSPSVTTEGQAVKPEPT
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed