Recombinant Human ZDHHC9 Protein

Beta LifeScience SKU/CAT #: BLA-9761P
Recombinant Human ZDHHC9 Protein

Recombinant Human ZDHHC9 Protein

Beta LifeScience SKU/CAT #: BLA-9761P
Catalog No.: BLA-9761P

Product Overview

Host Species Human
Synonym Antigen MMSA 1 Asp His His Cys domain containing protein 9 CGI89 CXorf11 DHHC-9 DHHC9 MMSA1 MRXSZ Palmitoyltransferase ZDHHC9 ZDHC9_HUMAN ZDHHC 9 ZDHHC10 ZDHHC9 Zinc finger DHHC domain containing 10 Zinc finger DHHC domain containing protein 9 Zinc finger DHHC domain-containing protein 9 Zinc finger DHHC type containing 9 Zinc finger protein 379 Zinc finger protein 380 ZNF379 ZNF380
Description Recombinant Human ZDHHC9 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCT LFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPD EAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPP RASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFA FNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLV ALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG ILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPP EPPEPPQEAAEAEK
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed