Recombinant Human ZBTB7A Protein

Beta LifeScience SKU/CAT #: BLA-9755P
Recombinant Human ZBTB7A Protein

Recombinant Human ZBTB7A Protein

Beta LifeScience SKU/CAT #: BLA-9755P
Catalog No.: BLA-9755P

Product Overview

Host Species Human
Accession Q8TB76
Synonym DKFZp547O146 Factor binding IST protein 1 Factor that binds to inducer of short transcripts protein 1 FBI-1 FBI1 HIV-1 1st-binding protein 1 HIV-1 inducer of short transcripts binding protein HIV-1 inducer of short transcripts-binding factor 1 Leukemia/lymphoma-related factor LRF lymphoma related factor MGC99631 POK erythroid myeloid ontogenic factor Pokemon POZ and Krueppel erythroid myeloid ontogenic factor TIP21 TTF-I-interacting peptide 21 ZBT7A_HUMAN ZBTB7 ZBTB7A Zinc finger and BTB domain containing 7A zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein Zinc finger and BTB domain-containing protein 7A Zinc finger protein 857A Zinc finger- and BTB domain-containing protein 7 ZNF857A
Description Recombinant Human ZBTB7A Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMV LVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKP SVVAERGA
Molecular Weight 38 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed