Recombinant Human ZBTB7A Protein
Beta LifeScience
SKU/CAT #: BLA-9755P
Recombinant Human ZBTB7A Protein
Beta LifeScience
SKU/CAT #: BLA-9755P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8TB76 |
Synonym | DKFZp547O146 Factor binding IST protein 1 Factor that binds to inducer of short transcripts protein 1 FBI-1 FBI1 HIV-1 1st-binding protein 1 HIV-1 inducer of short transcripts binding protein HIV-1 inducer of short transcripts-binding factor 1 Leukemia/lymphoma-related factor LRF lymphoma related factor MGC99631 POK erythroid myeloid ontogenic factor Pokemon POZ and Krueppel erythroid myeloid ontogenic factor TIP21 TTF-I-interacting peptide 21 ZBT7A_HUMAN ZBTB7 ZBTB7A Zinc finger and BTB domain containing 7A zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein Zinc finger and BTB domain-containing protein 7A Zinc finger protein 857A Zinc finger- and BTB domain-containing protein 7 ZNF857A |
Description | Recombinant Human ZBTB7A Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMV LVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKP SVVAERGA |
Molecular Weight | 38 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |