Recombinant Human ZAN Protein

Beta LifeScience SKU/CAT #: BLA-9750P
Recombinant Human ZAN Protein

Recombinant Human ZAN Protein

Beta LifeScience SKU/CAT #: BLA-9750P
Catalog No.: BLA-9750P

Product Overview

Host Species Human
Synonym OTTHUMP00000211358 OTTHUMP00000211359 OTTHUMP00000211360 OTTHUMP00000211361 OTTHUMP00000211362 OTTHUMP00000211363 ZAN ZAN_HUMAN Zonadhesin
Description Recombinant Human ZAN Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence KEKPPDQKLVVRSSRDNYVLTQCDFEDDAKPLCDWSQVSADDEDWVRASG PSPTGSTGAPGGYPNGEGSYLHMESNSFHRGGVARLLSPDLWEQG
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed