Recombinant Human ZAN Protein
Beta LifeScience
SKU/CAT #: BLA-9750P
Recombinant Human ZAN Protein
Beta LifeScience
SKU/CAT #: BLA-9750P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | OTTHUMP00000211358 OTTHUMP00000211359 OTTHUMP00000211360 OTTHUMP00000211361 OTTHUMP00000211362 OTTHUMP00000211363 ZAN ZAN_HUMAN Zonadhesin |
Description | Recombinant Human ZAN Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | KEKPPDQKLVVRSSRDNYVLTQCDFEDDAKPLCDWSQVSADDEDWVRASG PSPTGSTGAPGGYPNGEGSYLHMESNSFHRGGVARLLSPDLWEQG |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |