Recombinant Human XCL1 Protein

Beta LifeScience SKU/CAT #: BLA-9737P
Recombinant Human XCL1 Protein

Recombinant Human XCL1 Protein

Beta LifeScience SKU/CAT #: BLA-9737P
Catalog No.: BLA-9737P

Product Overview

Host Species Human
Accession P47992
Synonym ATAC Chemokine (C motif) ligand 1 Cytokine SCM1 LPTN LTN Lymphotactin Lymphotaxin SCM1 SCM1 alpha SCM1a SCYC1 Small inducible cytokine C1 XC chemokine ligand 1
Description Recombinant Human XCL1 Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADP QATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Molecular Weight 10 kDa
Purity >98% SDS-PAGE.>98% as determined by SDS-PAGE and HPLC.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 10-100 ng/ml.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed