Recombinant Human WSTF Protein
Beta LifeScience
SKU/CAT #: BLA-9723P
Recombinant Human WSTF Protein
Beta LifeScience
SKU/CAT #: BLA-9723P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9UIG0 |
Synonym | baz1b BAZ1B_HUMAN Bromodomain adjacent to zinc finger domain protein 1B hWALP 2 hWALP-2 hWALP2 transcription factor WSTF Tyrosine-protein kinase BAZ1B WALP-2 WALP2 WBRS 9 WBRS-9 WBRS9 WBSC 10 WBSC-10 WBSC10 WBSCR10 WBSCR9 Williams Beuren syndrome chromosome region 9 protein Williams syndrome transcription factor Williams-Beuren syndrome chromosomal region 10 protein Williams-Beuren syndrome chromosomal region 9 protein WSTF |
Description | Recombinant Human WSTF Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKRSSRRQSLELQKCEEILH KIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRSVQE FLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYV |
Molecular Weight | 41 kDa including tags |
Purity | >= 80% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |