Recombinant Human WSTF Protein

Beta LifeScience SKU/CAT #: BLA-9723P
Recombinant Human WSTF Protein

Recombinant Human WSTF Protein

Beta LifeScience SKU/CAT #: BLA-9723P
Catalog No.: BLA-9723P

Product Overview

Host Species Human
Accession Q9UIG0
Synonym baz1b BAZ1B_HUMAN Bromodomain adjacent to zinc finger domain protein 1B hWALP 2 hWALP-2 hWALP2 transcription factor WSTF Tyrosine-protein kinase BAZ1B WALP-2 WALP2 WBRS 9 WBRS-9 WBRS9 WBSC 10 WBSC-10 WBSC10 WBSCR10 WBSCR9 Williams Beuren syndrome chromosome region 9 protein Williams syndrome transcription factor Williams-Beuren syndrome chromosomal region 10 protein Williams-Beuren syndrome chromosomal region 9 protein WSTF
Description Recombinant Human WSTF Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKRSSRRQSLELQKCEEILH KIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRSVQE FLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYV
Molecular Weight 41 kDa including tags
Purity >= 80% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed