Recombinant Human WHSC1/NSD2 Protein

Beta LifeScience SKU/CAT #: BLA-9705P
Recombinant Human WHSC1/NSD2 Protein

Recombinant Human WHSC1/NSD2 Protein

Beta LifeScience SKU/CAT #: BLA-9705P
Catalog No.: BLA-9705P

Product Overview

Host Species Human
Synonym FLJ23286 IL5 promoter REII region binding protein KIAA1090 MGC176638 MMSET MMSET type II Multiple myeloma SET domain containing protein type III Multiple myeloma SET domain protein Multiple myeloma SET domain-containing protein NSD 2 NSD2 NSD2_HUMAN Nuclear receptor binding SET domain protein 2 Nuclear SET domain-containing protein 2 Probable histone-lysine N-methyltransferase NSD2 Protein trithorax-5 REIIBP Trithorax/ash1 related protein 5 TRX5 TRX5 protein WHS Whsc1 Wolf Hirschhorn syndrome candidate 1 Wolf Hirschhorn syndrome candidate 1 protein Wolf-Hirschhorn syndrome candidate 1 protein
Description Recombinant Human WHSC1/NSD2 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSK AQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRF ESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAAD VSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKI PAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYT KLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVG DQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRR RRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPR SRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRA RYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAEAEDTPRKRLR TDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR NRASTAASSALGFSKSSSPSASLTENELLWEPTPVKLDLNPAALYCT
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed