Recombinant Human WDR62 Protein

Beta LifeScience SKU/CAT #: BLA-9693P
Recombinant Human WDR62 Protein

Recombinant Human WDR62 Protein

Beta LifeScience SKU/CAT #: BLA-9693P
Catalog No.: BLA-9693P

Product Overview

Host Species Human
Synonym C19orf14 Chromosome 19 open reading frame 14 FLJ33298 MCPH2 MGC166976 WD repeat domain 62
Description Recombinant Human WDR62 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MKPESLENSILDSLEPQSLASLLSESESPQEAGRGHPSFLPQQKESSEAS ELILYSLEAEVTVTGTDSQYCRKEVEAGPGDQQGDSYLRVSSDSPKDQSP PEDSGESEADLECSFAAIHSPAPPPDPAPRFATSLPHFPGCAGPTEDELS LPEGPSVPSSSLPQTPEQEKFLRHHFETLTESPCRALGDVEASEAEDHFF NPRLSISTQFLSSLQKASRFTHTFPPRATQCLVKSPEVKLMDRGGSQPRA GTGYASPDRTHVLAAGKAEETLEAWRPPPPCLTSLASCVPASSVLPTDRN LPTPTSAPTPGLAQGVHAPSTCSYMEATASSRARISRSISLGDSEGPIVA TLAQPLRRPSSVGELASLGQELQAITTATTPSLDSEGQEPALRSWGNHEA RANLRLTLSSACDGLLLPPVDTQPGVTVPAVSFPAPSPVEESALRLHGSA FRPSLPAPESPGLPAHPSNPQLPEARPGIPGSTASLLEPTSGALGLFQGS PARWSEPWVPVEALPPSPLELSRVGNILHRLQTTFQEALDLYRVLVSSGQ VDTGQQQARTELVSTFLWIHSQLEAECLVGTSVAPAQALPSPGPPSPPTL YPLASPDLQALLEHYSELLVQAVRRKARGH
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed