Recombinant Human VR1 Protein

Beta LifeScience SKU/CAT #: BLA-9671P
Recombinant Human VR1 Protein

Recombinant Human VR1 Protein

Beta LifeScience SKU/CAT #: BLA-9671P
Catalog No.: BLA-9671P

Product Overview

Host Species Human
Synonym Capsaicin receptor DKFZp434K0220 osm 9 like TRP channel 1 Osm-9-like TRP channel 1 OTRPC1 Transient receptor potential cation channel subfamily V member 1 TRPV 1 Trpv1 TRPV1_HUMAN Vanilloid receptor 1 Vanilloid receptor subtype 1 VR 1 VR1
Description Recombinant Human VR1 Protein was expressed in Wheat germ. It is a Protein fragment
Source Wheat germ
AA Sequence CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGEL DSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFE AVAQ
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed