Recombinant Human VPS26 Protein

Beta LifeScience SKU/CAT #: BLA-9660P
Recombinant Human VPS26 Protein

Recombinant Human VPS26 Protein

Beta LifeScience SKU/CAT #: BLA-9660P
Catalog No.: BLA-9660P

Product Overview

Host Species Human
Accession O75436
Synonym FLJ12930 HB 58 HB58 Hbeta 58 Hbeta 58 homolog Hbeta58 Hbeta58 homolog hVPS 26 hVPS26 MGC94168 PEP 8A PEP8A Vacuolar protein sorting 26 Vacuolar protein sorting 26 A Vacuolar protein sorting 26 homolog A Vacuolar protein sorting 26 homolog A S. pombe Vacuolar protein sorting 26 homolog A yeast Vacuolar protein sorting 26 yeast Vacuolar protein sorting 26 yeast homolog Vacuolar protein sorting 26A Vacuolar protein sorting associated protein 26A Vacuolar protein sorting-associated protein 26A Vesicle protein sorting 26 Vesicle protein sorting 26A VP26A_HUMAN VPS 26 VPS 26A VPS26A
Description Recombinant Human VPS26 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSMSFLGGFFGPICEIDIVLNDGETRKMA EMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIE LFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVR LRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIE FEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTET ETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLV LVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM
Molecular Weight 41 kDa including tags
Purity Greater than 85% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed