Recombinant Human VNN1/Vanin-1 Protein

Beta LifeScience SKU/CAT #: BLA-9650P
Recombinant Human VNN1/Vanin-1 Protein

Recombinant Human VNN1/Vanin-1 Protein

Beta LifeScience SKU/CAT #: BLA-9650P
Catalog No.: BLA-9650P

Product Overview

Host Species Human
Accession O95497
Synonym HDLCQ8 High density lipoprotein cholesterol level quantitative trait locus 8, included Pantetheinase Pantetheine hydrolase Tiff66 V-1 Vanin 1 Vanin-1 Vannin 1 Vascular non inflammatory molecule 1 Vascular non-inflammatory molecule 1 VNN 1 VNN1 VNN1_HUMAN
Description Recombinant Human VNN1/Vanin-1 Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence QDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDILEGAITSAADQG AHIIVTPEDAIYGWNFNRDSLYPYLEDIPNPEVNWIPCNNRNRFGQTPVQ ERLSCLAKNNSIYVVANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGK LVARYHKQNLFMGENQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAV TLVKDFHVDTIVFPTAWMNVLPHLSAVEFHSAWAMGMRVNFLASNIHYPS KKMTGSGIYAPNSSRAFHYDMKTEEGKLLLSQLDSHPSHSAVVNWTSYAS SIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSE NIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETASTR FEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVL TVTLFGRLYEKDWASNASSVDHHHHHH
Molecular Weight 53 kDa including tags
Purity >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -80°C.
Recently viewed