Recombinant Human Vitamin D Binding Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9639P
Recombinant Human Vitamin D Binding Protein (Tagged)

Recombinant Human Vitamin D Binding Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9639P
Catalog No.: BLA-9639P

Product Overview

Host Species Human
Accession P02774
Synonym DBP DBP/GC GC Gc globulin Gc-globulin GRD3 Group specific component Group specific component vitamin D binding protein Group-specific component hDBP VDB VDBG VDBP Vitamin D binding alpha globulin Vitamin D-binding protein VTDB_HUMAN
Description Recombinant Human Vitamin D Binding Protein (Tagged) was expressed in Yeast. It is a Protein fragment
Source Yeast
AA Sequence RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVV SLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLE RKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYG QAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNR VCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCES ASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAA QLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPT LKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEY KKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDA ELKNIL
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed