Recombinant Human VISTA Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-9636P
Recombinant Human VISTA Protein (Fc Tag)

Recombinant Human VISTA Protein (Fc Tag)

Beta LifeScience SKU/CAT #: BLA-9636P
Catalog No.: BLA-9636P

Product Overview

Host Species Human
Accession Q9H7M9
Synonym B7 H5 B7H5 C10orf54 chromosome 10 open reading frame 54 DD1alpha GI24 GI24_HUMAN PD-1H PDCD1 homolog Platelet receptor Gi24 PP2135 sisp 1 SISP1 stress induced secreted protein 1 UNQ730/PRO1412 V domain Ig suppressor of T cell activation V set domain containing immunoregulatory receptor V set immunoregulatory receptor V type immunoglobulin domain containing suppressor of T cell activation VISTA
Description Recombinant Human VISTA Protein (Fc Tag) was expressed in HEK293. It is a Protein fragment
Source HEK293
AA Sequence FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQT CSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSIT MRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYP SSSQDSENITAAIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight 47 kDa including tags
Purity >= 90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed