Recombinant Human VDAC1/Porin Protein
Beta LifeScience
SKU/CAT #: BLA-9612P
Recombinant Human VDAC1/Porin Protein
Beta LifeScience
SKU/CAT #: BLA-9612P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P21796 |
Synonym | N2441 OMP2 POR1 hVDAC1 MGC111064 Mitochondrial Porin Outer mitochondrial membrane protein porin 1 Plasmalemmal porin Porin 31HL Porin 31HM VDAC VDAC-1 Vdac1 VDAC1_HUMAN Voltage dependent anion channel 1 Voltage dependent anion selective channel protein 1 Voltage-dependent anion-selective channel protein 1 YNL055C YNL2441C |
Description | Recombinant Human VDAC1/Porin Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTE TTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD SSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNK KLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQT LKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA |
Molecular Weight | 57 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. Binds various signaling molecules, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterol cholesterol. In depolarized mitochondria, acts downstream of PRKN and PINK1 to promote mitophagy or prevent apoptosis; polyubiquitination by PRKN promotes mitophagy, while monoubiquitination by PRKN decreases mitochondrial calcium influx which ultimately inhibits apoptosis. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis. May mediate ATP export from cells. |
Subcellular Location | Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein. |
Protein Families | Eukaryotic mitochondrial porin family |
Database References | |
Tissue Specificity | Expressed in erythrocytes (at protein level). Expressed in heart, liver and skeletal muscle. |
Gene Functions References
- VDAC1 allows Ca(2+) access to the MCU, facilitating transport of Ca(2+) to the matrix, and also from the IMS to the cytosol. Intra-mitochondrial Ca(2+) controls energy production and metabolism by modulating critical enzymes in the tricarboxylic acid (TCA) cycle and fatty acid oxidation. PMID: 29594867
- associate dysfunction in Fe-S cluster biogenesis with cleavage of VDAC1 PMID: 29596470
- HK1 competes with SOD1 G93A mutant from familial amyotrophic lateral sclerosis cases for binding VDAC1.SOD1 G93A mutant from familial amyotrophic lateral sclerosis cases binds VDAC1 with high affinity. PMID: 27721436
- Study shows that silencing voltage-dependent anion channel 1 (VDAC1) expression using short interfering RNA-VDAC1 in 9 glioblastoma-related cell lines, including patient-derived cells, led to marked decreases in VDAC1 levels and cell growth. PMID: 28339833
- VDAC1 plays an important role in dengue virus infection. PMID: 27779201
- VDAC1 is a direct target of miR-320a in non-small cell lung cancer (NSCLC) cells, and miR-320a inhibits VDAC1 expression in NSCLC cells PMID: 27304056
- The results of this study shown VDAC1, the Potential Target of miR-320a, is Upregulated in Response to HIV-1 Tat. PMID: 27761954
- the present study indicated that VDAC1 may interact with HPV16 E7 to promote the malignant progression of HPV-related cervical cancer PMID: 27419626
- Porin expression was lower in patients with heart failure with preserved ejection fraction compared to controls. PMID: 27179829
- Studied voltage-dependent anion channel 1 (VDAC1) structure and oligomerization using an Escherichia coli cell-free protein synthesis system and bicelle crystallization. PMID: 28608415
- In this study, molecular dynamics simulations and single-channel experiments of VDAC-1 show agreement for the current-voltage relationships of an "open" channel and they also show several subconducting transient states that are more cation selective in the simulations. We observed voltage-dependent asymmetric distortions of the VDAC-1 barrel and the displacement of particular charged amino acids. PMID: 27653481
- VDAC1 was accumulated in the desmin highly stained area of muscle fibers of desminopathy patients. PMID: 27941998
- work raises the interesting possibility that cholesterol-mediated regulation of VDAC1 may be facilitated through a specific binding site at the functionally important Glu(73) residue. PMID: 28396346
- this study describes novel drug candidates with a defined mechanism of action that involves inhibition of VDAC1 oligomerization, apoptosis, and mitochondrial dysfunction. The compounds VBIT-3 and VBIT-4 offer a therapeutic strategy for treating different diseases associated with enhanced apoptosis and point to VDAC1 as a promising target for therapeutic intervention. PMID: 27738100
- Results from the simulations show that HK2 binding restricts the movement of the VDAC1 N-terminal helix. As a result, VDAC1 is kept in the open state most of the time and probably allows a constant supply of ATP to HK2 for glycolysis. PMID: 27544294
- The findings of this study suggest that inhibition of intracellular Ca(2+/-) overload could protect cells from damage and that VDAC1 plays a considerable role in Cr(VI)-induced liver injury. PMID: 27898307
- Our study suggested that miR-7 suppressed the expression of VDAC1 in hepatocellular carcinoma PMID: 26831666
- Results shows that beta-barrel of human VDAC1 embedded into a membrane is highly flexible and that Ca2+, a key regulator of metabolism and apoptosis, strongly decreases its plasticity suggesting that physiological VDAC function depends on the molecular plasticity of its channel. PMID: 27021164
- High VDAC1 expression is associated with cervical cancer. PMID: 26716410
- Studies using B16F10 and A375 cells genetically modified for ATF2 indicated that mitochondrial ATF2 was able to dissociate Bim from the Mcl-1/Bim complex to trigger VDAC1 oligomerization. PMID: 26462148
- findings also suggest that VDAC1 may be a novel biomarker for gastric cancer PMID: 26646027
- serum starvation induces CREB1 expression, in turn activating miR-320a expression, which then down-regulates VDAC1 expression to facilitate mitophagy PMID: 26472185
- Reducing VDAC1 expression induces a non-apoptotic role for pro-apoptotic proteins in glioblastoma multiforme cancer cell differentiation. PMID: 27080741
- The works available on VDAC cysteines support the notion that VDAC1, VDAC2, and VDAC3 proteins are paralogs with a similar pore-function and slightly different, but important, ancillary biological functions. (Review) PMID: 26947058
- The protective effect of miR-7 is partly exerted through promoting mitochondrial function by targeting VDAC1 expression. PMID: 26801612
- Data show that voltage-dependent anion channel 1 (VDAC1) knockout cells are resistant to AMP-activated protein kinase (AMPK) and mechanistic target of rapamycin (mTOR) modulation by itraconazole, indicating VDAC1 is the mediator of the activity. PMID: 26655341
- Amyloid beta -mediated toxicity involves mitochondrial and plasma membrane VDAC1, leading to mitochondrial dysfunction and apoptosis induction. PMID: 26542804
- PGC-1alpha deficiency exacerbates high glucose-induced apoptosis in human umbilical vein endothelial cells through activation of VADC1. PMID: 26191154
- The serum lever of Alzheimer's disease were increase and the expression of VDAC1 strongly correlated with the Mini-Mental State Examination scores of the AD patients. PMID: 25502766
- VDAC1 is involved in the process of mitochondria-mediated apoptosis by mediating the release of apoptotic proteins and interacting with anti-apoptotic proteins. (Review) PMID: 25448878
- The functional interactions between VDAC and alpha-syn, revealed by the present study, point toward the long sought after physiological and pathophysiological roles for monomeric alpha-syn in PD and in other alpha-synucleinopathies PMID: 26055708
- Results show that BNIP3 interacts with the voltage-dependent anion channel (VDAC) to directly induce mitochondrial release and nuclear translocation of EndoG. PMID: 25436615
- TP53 regulation of VDAC1 cleavage occurs through mitochondrial Mieap and is dependent on the endolysosomal pH. PMID: 25691661
- These data suggest that an interaction between Mcl-1 and VDAC promotes lung cancer cell migration by a mechanism that involves Ca(2+)-dependent reactive oxygen species production. PMID: 25341036
- data indicate that the BH4 domain of Bcl-XL, but not that of Bcl-2, selectively targets VDAC1 and inhibits apoptosis by decreasing VDAC1-mediated Ca(2+) uptake into the mitochondria PMID: 25681439
- Voltage-dependent structural changes of hVDAC1 PMID: 24728177
- VDAC1 was expressed and reconstituted into two-dimensional lipid crystalline bilayers with characteristics identical to wild type samples. PMID: 25545271
- Results indicate that mitochondrial function associated with VDAC1 is decreased in sporadic and experimental Parkinson's disease, and this decrease is associated with alpha-synuclein accumulation and aggregation PMID: 24825319
- Data indicate that voltage-dependent anion channel 1 (VDAC1) is involved in plasminogen kringle 5 (K5)-induced activation of the mitochondrial apoptosis pathway. PMID: 25296756
- Data indicate that curcumin interacts with residues in the alpha helical N-terminus of voltage dependent anion channel VDAC-1 and in the channel wall. PMID: 25459681
- Ca(2+)-mediated regulation of VDAC1 expression levels is associated with cell death induction. PMID: 24704533
- Label-free quantitative comparison of DN urinary exosomes vs control group and SRM further validation, resulted in the discovery of a panel of three proteins (AMBP, MLL3 and VDAC1) which changes in DN. PMID: 24211404
- the C-terminus end of VDAC faces the mitochondrial inter-membrane space. PMID: 24324700
- This review examines the significance of this new form of VDAC1 for anticancer therapy.[review] PMID: 24272356
- Nucleotide interactions of the human voltage-dependent anion channel. PMID: 24668813
- Increase in mRNA levels of the voltage-dependent anion channel 1 gene is associated with Alzheimer's disease. PMID: 24063855
- Abnormal interaction of VDAC1 with amyloid beta and phosphorylated tau causes mitochondrial dysfunction in Alzheimer's disease. PMID: 22926141
- VDAC binds tissue-type plasminogen activator (t-PA) on human neuroblastoma SK-N-SH cells PMID: 23161549
- VDAC 1, 2, and 3 recruit Parkin to defective mitochondria to promote mitochondrial autophagy. PMID: 23060438
- The N-terminal helix of VDAC1 controls entry into elliptic beta-barrel states which underlie VDAC closure. PMID: 22841291