Recombinant Human VDAC1/Porin Protein

Beta LifeScience SKU/CAT #: BLA-9612P
Recombinant Human VDAC1/Porin Protein

Recombinant Human VDAC1/Porin Protein

Beta LifeScience SKU/CAT #: BLA-9612P
Catalog No.: BLA-9612P

Product Overview

Host Species Human
Accession P21796
Synonym N2441 OMP2 POR1 hVDAC1 MGC111064 Mitochondrial Porin Outer mitochondrial membrane protein porin 1 Plasmalemmal porin Porin 31HL Porin 31HM VDAC VDAC-1 Vdac1 VDAC1_HUMAN Voltage dependent anion channel 1 Voltage dependent anion selective channel protein 1 Voltage-dependent anion-selective channel protein 1 YNL055C YNL2441C
Description Recombinant Human VDAC1/Porin Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTE TTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD SSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNK KLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQT LKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Molecular Weight 57 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed