Recombinant Human VASH1 Protein

Beta LifeScience SKU/CAT #: BLA-9586P
Recombinant Human VASH1 Protein

Recombinant Human VASH1 Protein

Beta LifeScience SKU/CAT #: BLA-9586P
Catalog No.: BLA-9586P

Product Overview

Host Species Human
Synonym KIAA1036 VASH VASH1 VASH1_HUMAN Vasohibin 1 Vasohibin-1
Description Recombinant Human VASH1 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGE EDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD LPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPL TGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESE GGVG
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed