Recombinant Human USP5 Protein

Beta LifeScience SKU/CAT #: BLA-9562P
Recombinant Human USP5 Protein

Recombinant Human USP5 Protein

Beta LifeScience SKU/CAT #: BLA-9562P
Catalog No.: BLA-9562P

Product Overview

Host Species Human
Accession P45974
Synonym Deubiquitinating enzyme 5 Isopeptidase T ISOT ISOT 1 Ubiquitin carboxyl-terminal hydrolase 5 Ubiquitin isopeptidase T Ubiquitin specific peptidase 5 Ubiquitin specific peptidase 5 (isopeptidase T) Ubiquitin specific processing protease 5 Ubiquitin specific protease 5 (isopeptidase T) Ubiquitin specific protease 5 (ubiquitin isopeptidase T) Ubiquitin thioesterase 5 Ubiquitin thiolesterase 5 Ubiquitin-specific-processing protease 5 UBP5_HUMAN Usp5
Description Recombinant Human USP5 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence AELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFL GFGKQYVERHFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAI GVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLPDIVRDRVTSAV EALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSK CDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTI TPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDMN QRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQ RKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGER VPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERNC RSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLPVPMDAALNKEE LLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPEQVDDFWSTALQ AKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQ LRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPT SPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDF ANPLILPGSSGPGSTSAAADPPPEDCVTTIVSMGFSRDQALKALRATNNS LERAVDWIFSHIDDLDAEAAMDISEGRSAADSISESVPVGPKVRDGPGKY QLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKPPKDLGYIY FYQRVAS
Molecular Weight 96 kDa including tags
Purity >= 55% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific Activity: 786 pmol/min/µg
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed