Recombinant Human USP24 Protein
Beta LifeScience
SKU/CAT #: BLA-9548P
Recombinant Human USP24 Protein
Beta LifeScience
SKU/CAT #: BLA-9548P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | Deubiquitinating enzyme 24 KIAA1057 Ubiquitin carboxyl terminal hydrolase 24 Ubiquitin carboxyl-terminal hydrolase 24 Ubiquitin specific peptidase 24 Ubiquitin specific processing protease 24 Ubiquitin specific protease 24 Ubiquitin thioesterase 24 Ubiquitin thiolesterase 24 Ubiquitin-specific-processing protease 24 UBP24_HUMAN Usp24 |
Description | Recombinant Human USP24 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MISFLLGASRQNNQIRRWSSAQAREFGNLHNTVALLVLHSDVSSQRNVAP GIFKQRPPISIAPSSPLLPLHEEVEALLFMSEGKPYLLEVMFALRELTGS LLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEILV IEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCP AAKEYFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTIS AQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQGSESPMMIGEL RSDLDDVDP |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |