Recombinant Human USP24 Protein

Beta LifeScience SKU/CAT #: BLA-9548P
Recombinant Human USP24 Protein

Recombinant Human USP24 Protein

Beta LifeScience SKU/CAT #: BLA-9548P
Catalog No.: BLA-9548P

Product Overview

Host Species Human
Synonym Deubiquitinating enzyme 24 KIAA1057 Ubiquitin carboxyl terminal hydrolase 24 Ubiquitin carboxyl-terminal hydrolase 24 Ubiquitin specific peptidase 24 Ubiquitin specific processing protease 24 Ubiquitin specific protease 24 Ubiquitin thioesterase 24 Ubiquitin thiolesterase 24 Ubiquitin-specific-processing protease 24 UBP24_HUMAN Usp24
Description Recombinant Human USP24 Protein was expressed in Wheat germ. It is a Full length protein
Source Wheat germ
AA Sequence MISFLLGASRQNNQIRRWSSAQAREFGNLHNTVALLVLHSDVSSQRNVAP GIFKQRPPISIAPSSPLLPLHEEVEALLFMSEGKPYLLEVMFALRELTGS LLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEILV IEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCP AAKEYFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTIS AQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQGSESPMMIGEL RSDLDDVDP
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed