Recombinant Human USP14/TGT Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9537P
Recombinant Human USP14/TGT Protein (Tagged)

Recombinant Human USP14/TGT Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9537P
Catalog No.: BLA-9537P

Product Overview

Host Species Human
Accession P54578
Synonym Deubiquitinating enzyme 14 TGT tRNA guanine transglycosylase tRNA guanine transglycosylase 60 kD subunit Ubiquitin carboxyl terminal hydrolase 14 Ubiquitin carboxyl-terminal hydrolase 14 Ubiquitin specific peptidase 14 Ubiquitin specific processing protease 14 Ubiquitin specific protease 14 Ubiquitin thiolesterase 14 Ubiquitin-specific-processing protease 14 UBP14_HUMAN USP 14 USP14
Description Recombinant Human USP14/TGT Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKG GTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASA MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQ YITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDA NECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVE FETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVK YEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKF DDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Molecular Weight 56 kDa
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed