Recombinant Human USH1C/Harmonin Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9528P
Recombinant Human USH1C/Harmonin Protein (Tagged)

Recombinant Human USH1C/Harmonin Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-9528P
Catalog No.: BLA-9528P

Product Overview

Host Species Human
Accession Q9Y6N9-4
Synonym AIE 75 AIE75 Antigen NY CO 38/NY CO 37 Antigen NY-CO-38/NY-CO-37 Autoimmune enteropathy related antigen AIE 75 Autoimmune enteropathy related antigen AIE75 Autoimmune enteropathy-related antigen AIE-75 Deafness autosomal recessive 18 DFNB 18 DFNB18 Harmonin NY CO 37 NY CO 38 PDZ 45 PDZ 73 PDZ 73 protein PDZ 73/NY CO 38 PDZ45 PDZ73 PDZ73 protein Protein PDZ-73 Renal carcinoma antigen NY REN 3 Renal carcinoma antigen NY-REN-3 USH 1C USH1C USH1C_HUMAN Ush1cpst Usher syndrome 1C Usher syndrome 1C (autosomal recessive severe) Usher syndrome type 1C protein Usher syndrome type-1C protein
Description Recombinant Human USH1C/Harmonin Protein (Tagged) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVI NEPSRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGL SVRGGLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEV INLIRTKKTVSIKVRHIGLIPVKSSPDEPLTWQYVDQFVSESGGVRGSLG SPGNRENKEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEV GLEIGDQIVEVNGVDFSNLDHKEGRELFMTDRERLAEARQRELQRQELLM QKRLAMESNKILQEQQEMERQRRKEIAQKAAEENERYRKEMEQIVEEEEK FKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLD GGTEEQGEQDFRKYEEGFDPYSMFTPEQIMGKDVRLLRIKKEGSLDLALE GGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAE AALQKAWNQGGDWIDLVVAVCPPKEYDDELTFF
Molecular Weight 76 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed