Recombinant Human Uroplakin III Protein

Beta LifeScience SKU/CAT #: BLA-9522P
Recombinant Human Uroplakin III Protein

Recombinant Human Uroplakin III Protein

Beta LifeScience SKU/CAT #: BLA-9522P
Catalog No.: BLA-9522P

Product Overview

Host Species Human
Accession O75631
Synonym MGC119178 OTTHUMP00000028951 UP III UP3a UPIII UPIIIA UPK 3 UPK 3A UPK3 UPK3A UPK3A_HUMAN Uroplakin 3A Uroplakin III Uroplakin-3a Uroplakin3A UroplakinIII
Description Recombinant Human Uroplakin III Protein was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALE KPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTE GGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCL WDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTP YSTIDTWPGRRSGG
Molecular Weight 23 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed