Recombinant Human ULBP2 Protein

Beta LifeScience SKU/CAT #: BLA-9488P
Recombinant Human ULBP2 Protein

Recombinant Human ULBP2 Protein

Beta LifeScience SKU/CAT #: BLA-9488P
Catalog No.: BLA-9488P

Product Overview

Host Species Human
Accession Q9BZM5
Synonym ALCAN alpha ALCAN-alpha N2DL 2 N2DL-2 N2DL2 N2DL2_HUMAN NKG2D ligand 2 NKG2D ligand 2 precursor NKG2DL2 RAET1H Retinoic acid early transcript 1 H Retinoic acid early transcript 1H UL16 binding protein 2 UL16-binding protein 2 ULBP2
Description Recombinant Human ULBP2 Protein was expressed in HEK293. It is a Full length protein
Source HEK293
AA Sequence GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVS PLGKKLNVTT AWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHS SGSWQFSFDG QIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLE DFLMGMDSTL EPSAGAPLAMSSVDHHHHHH
Molecular Weight 23 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. After reconstitution store at -20°C. Avoid freeze / thaw cycle.
Recently viewed