Recombinant Human UHRF1 Protein

Beta LifeScience SKU/CAT #: BLA-9485P
Recombinant Human UHRF1 Protein

Recombinant Human UHRF1 Protein

Beta LifeScience SKU/CAT #: BLA-9485P
Catalog No.: BLA-9485P

Product Overview

Host Species Human
Accession Q96T88
Synonym Ac2-121 AL022808 E3 ubiquitin-protein ligase UHRF1 EC 6.3.2.- FLJ21925 hNP95 hUHRF1 HuNp95 ICBP90 Inverted CCAAT box binding protein of 90 kDa Inverted CCAAT box binding protein, 90-kD Inverted CCAAT box-binding protein of 90 kDa Liver regeneration-related protein LRRG126 MGC138707 NP95 Nuclear phosphoprotein 95 Nuclear phosphoprotein, 95-KD Nuclear protein 95 Nuclear zinc finger protein Np95 RING finger protein 106 RNF106 TDRD22 Transcription factor ICBP90 Ubiquitin like containing PHD and RING finger domains protein 1 Ubiquitin like PHD and RING finger domain containing protein 1 Ubiquitin-like PHD and RING finger domain-containing protein 1 Ubiquitin-like protein containing PHD and RING finger domains 1 Ubiquitin-like with PHD and ring finger domains 1 Ubiquitin-like, containing PHD and RING finger domains, 1 Ubiquitin-like-containing PHD and RING finger domains protein 1 UHRF1 UHRF1_HUMAN
Description Recombinant Human UHRF1 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence MHHHHHHDYKDDDDKWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELF HVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKER DSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYK VNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHV KYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERG FWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEG SPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDEC DMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKM ASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQV SESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDL SGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVV RNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDE PGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGG FASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIRE DKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPIT TVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLF PGYGNGR
Molecular Weight 92 kDa including tags
Purity >70% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
Recently viewed