Recombinant Human UGT1A1 Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-9483P
Recombinant Human UGT1A1 Protein (denatured)

Recombinant Human UGT1A1 Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-9483P
Catalog No.: BLA-9483P

Product Overview

Host Species Human
Accession P22309
Synonym BILIQTL1 Bilirubin specific UDPGT isozyme 1 bilirubin UDP glucuronosyltransferase 1 1 bilirubin UDP glucuronosyltransferase isozyme 1 Bilirubin-specific UDPGT isozyme 1 EC 2.4.1.17 GNT1 HUG BR1 HUG-BR1 HUGBR1 PHENOL/BILIRUBIN UDP GLUCURONOSYLTRANSFERASE UD11_HUMAN UDP glucuronosyltransferase 1 1 [Precursor] UDP glucuronosyltransferase 1 family polypeptide A1 UDP glucuronosyltransferase 1A1 UDP GLYCOSYLTRANSFERASE 1 UDP-glucuronosyltransferase 1-1 UDP-glucuronosyltransferase 1-A UDP-glucuronosyltransferase 1A1 UDPGT UDPGT 1-1 UGT 1A UGT-1A UGT1 UGT1 01 UGT1*1 UGT1-01 UGT1.1 UGT1A Ugt1a1 URIDINE DIPHOSPHATE GLUCURONOSYLTRANSFERASE, BILIRUBIN/PHENOL URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1 URIDINE DIPHOSPHATE GLYCOSYLTRANSFERASE 1 FAMILY, POLYPEPTIDE A1
Description Recombinant Human UGT1A1 Protein (denatured) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMGSHAGKILLIPVDGSHWLSMLGAIQQLQQ RGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQREDVKESFVSLGHNVFEN DSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDP FLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSD HMTFLQRVKNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSAS VWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEHGI VVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILV KWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAK RMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPV EPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLD
Molecular Weight 55 kDa including tags
Purity >90% purity as determined by SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed