Recombinant Human UFC1 Protein

Beta LifeScience SKU/CAT #: BLA-9473P
Recombinant Human UFC1 Protein

Recombinant Human UFC1 Protein

Beta LifeScience SKU/CAT #: BLA-9473P
Catalog No.: BLA-9473P

Product Overview

Host Species Human
Accession Q9Y3C8
Synonym CGI-126 HSPC155 Ubiquitin fold modifier conjugating enzyme 1 Ubiquitin-fold modifier-conjugating enzyme 1 UFC1 UFC1_HUMAN Ufm1 conjugating enzyme 1 Ufm1-conjugating enzyme 1
Description Recombinant Human UFC1 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMADEATRRVVSEIPVLKTNAGPRDRELWVQ RLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEF DIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVP KFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Molecular Weight 22 kDa including tags
Purity Greater than 90% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed