Recombinant Human UCK Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-9466P
Recombinant Human UCK Protein (denatured)

Recombinant Human UCK Protein (denatured)

Beta LifeScience SKU/CAT #: BLA-9466P
Catalog No.: BLA-9466P

Product Overview

Host Species Human
Accession Q9HA47
Synonym Cytidine monophosphate kinase Cytidine monophosphokinase 1 Cytidylate kinase Deoxycytidylate kinase FLJ12255 OTTHUMP00000022400 OTTHUMP00000022401 OTTHUMP00000022403 OTTHUMP00000022404 RP11-334J6.5 UCK 1 uck1 UCK1_HUMAN UMP-CMP kinase Uridine monophosphokinase 1 Uridine-cytidine kinase 1 Uridine/cytidine kinase 1 URK1
Description Recombinant Human UCK Protein (denatured) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMFYSQEIRDMFHLRLFVDTDSDVRLSRRVL RDVRRGRDLEQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAIN LIVQHIQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLE SS
Molecular Weight 18 kDa including tags
Purity >80% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed