Recombinant Human UCHL3 Protein

Beta LifeScience SKU/CAT #: BLA-9463P
Recombinant Human UCHL3 Protein

Recombinant Human UCHL3 Protein

Beta LifeScience SKU/CAT #: BLA-9463P
Catalog No.: BLA-9463P

Product Overview

Host Species Human
Accession P15374
Synonym Ubiquitin carboxyl-terminal hydrolase isozyme L3 Ubiquitin thioesterase L3 Ubiquitin thiolesterase Ubiquitin thiolesterase L3 UCH L3 UCH-L3 UCHL3 UCHL3_HUMAN
Description Recombinant Human UCHL3 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MGSSHHHHHHSSGLVPRGSHMEGQRWLPLEANPEVTNQFLKQLGLHPNWQ FVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDV TSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMS PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Molecular Weight 28 kDa including tags
Purity Greater than 95% SDS-PAGE
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Specific activity: >3,000 pmole/min/ug. Measured by the hydrolysis of Ubiquitin-AMC at pH 8.0, at 37°C.Activity Assay:Prepare a 100ul of recombinant UCH-L3 protein with various concentrations (0.48ng, 0.9ng) in assay buffer and equilibrate to 37°C for 10 minutes. (Assay buffer: 50mM Tris-HCl, 0.5 mM EDTA, 1 mM DTT, 0.1 mg/ml Ovalbumin, pH 8.0.)Add 50ul of 1uM Ubiquitin-AMC.Read at excitation wavelengths 355nm and emission 460nm for 5 minutes.- Ubiquitin-AMC - 96 Well Polystyrene Microplate, black- Fluorescent plate reader (PerkinElmer, VICTOR X3)
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle.
Recently viewed