Recombinant Human UCHL3 Protein

Beta LifeScience SKU/CAT #: BLA-9462P
Recombinant Human UCHL3 Protein

Recombinant Human UCHL3 Protein

Beta LifeScience SKU/CAT #: BLA-9462P
Catalog No.: BLA-9462P

Product Overview

Host Species Human
Accession P15374
Synonym Ubiquitin carboxyl-terminal hydrolase isozyme L3 Ubiquitin thioesterase L3 Ubiquitin thiolesterase Ubiquitin thiolesterase L3 UCH L3 UCH-L3 UCHL3 UCHL3_HUMAN
Description Recombinant Human UCHL3 Protein was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC AVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGL IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHET SAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDET LLEDAIEVCKKFMERDPDELRFNAIALSAA
Molecular Weight 27 kDa including tags
Purity >95% SDS-PAGE.Assessed by densitometry.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle.
Recently viewed